PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_00299.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family bZIP
Protein Properties Length: 514aa    MW: 56555.4 Da    PI: 6.9739
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_00299.1_g00016.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1231.7e-07189251163
                              XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                              eke +r  r   NRe+Ar   +R++a  eeL++k++ L +eN+ Lkk+ e   ke ++lk+++
  Sme2.5_00299.1_g00016.1 189 EKEERRLSRILANRESARQTIRRRQAMYEELTRKAADLASENENLKKKRELAAKEFDSLKNQN 251
                              577778888888************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-5185251No hitNo description
PfamPF001708.7E-7189251IPR004827Basic-leucine zipper domain
SMARTSM003387.2E-9189253IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.22191254IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.97E-5193250No hitNo description
CDDcd147024.91E-13194245No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MNDDFTPPYK AEKGKSSGGD GKDELVDCEL EAAQALACLA HPGSSGRSEA NLVNFKEFYI  60
KLLLFIIFSA SHFSGKLLEE DEEIVAVVVG SLAVRFSLVN CGGGSSGSRK MGLWTAGGPS  120
HHMQAETVLH HFFRLLLPPL LFQQLRRSAE QVITIQSNQE SEPKPSPQHA LRCPPGSSRR  180
SRQNLTEEEK EERRLSRILA NRESARQTIR RRQAMYEELT RKAADLASEN ENLKKKRELA  240
AKEFDSLKNQ NASLRLQISK TDKAEAEETD GASRSKPVEI SITSTAPAPN PTALFNQPPI  300
LPFFWPSIVQ PFNLLQCSTQ NISDIASVVP SPTAEELNSI NRQQSSNPGQ PFYVLPFPCL  360
IPFHPRSNPF LPCASTVTDR HAETPSAHQC STSYVSNQAA TARETEAEAP DSIKATQPGF  420
LHEAMLGFPP CRGASEGTRQ PSGVRSREMV PTTHQQEDTR DTNAVFCTAG HVGDTSERTS  480
QESVTCSSEE TAHAIAATEA RKRRKELLHL KGHH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1500505RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-98HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015086799.11e-178PREDICTED: uncharacterized protein DDB_G0284459
TrEMBLK4CR051e-176K4CR05_SOLLC; Uncharacterized protein
STRINGSolyc09g009760.1.11e-175(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54171724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.11e-29bZIP family protein